Home > Product > Antimicrobial Peptides > Vibi K

Antimicrobial Peptides

CAT#
AF1924
Sequence
GIPCGESCVWIPCLTSAVGCPCKSKVCYRN
Host Chemicals
Viola biflora
Length
30
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.