Home > Product > Antimicrobial Peptides > Vicin-like antimicrobial peptide 2c-1

Antimicrobial Peptides

Vicin-like antimicrobial peptide 2c-1

[Price Inquiry]
CAT#
AF3169
Sequence
RQRDPQQQYEQCQKRCQRRETEPRHMQICQQRCERRYEKEKRKQQ
Host Chemicals
Macadamia integrifolia
Length
45
Activity
Antibacterial, Antifungal
SwissProt ID
Q9SPL3
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.