Home > Product > Antimicrobial Peptides > Vicin-like antimicrobial peptide 2c-1

Antimicrobial Peptides

Vicin-like antimicrobial peptide 2c-1

Price Inquiry
CAT#
AF3169
Sequence
RQRDPQQQYEQCQKRCQRRETEPRHMQICQQRCERRYEKEKRKQQ
Host Chemicals
Macadamia integrifolia
Length
45
Activity
Antibacterial, Antifungal
SwissProt ID
Q9SPL3

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.