Keywords Search Google Search Search

Vicin-like antimicrobial peptide 2c-1

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3168
Sequence	RQRDPQQQYEQCQERCQRHETEPRHMQTCQQRCERRYEKEKRKQQ
Activity	Antibacterial, Antifungal

CAT#	Product Name	Inquiry
AF2562	PBD-2	Inquiry
AF862	Ib-AMP3	Inquiry
AF936	Nigrocin-1-OA2	Inquiry
AF2371	RK-2	Inquiry
AF905	NAI-802	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of R8-T198wt in prostate cancer

The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...

Calcitonin

Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...

Function of the Econazole and its derivative

Econazole, commonly used as sulfosalicylate and nitrate salt, is an imidazole broad-spectrum antifungal drug, wh ...

UFP-101-A Peptide Antagonist Selective for the Nociceptin/Orphanin FQ Receptor

Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...

A high affinity blocker for inward-rectifier K+ channels-Tertiapin-Q

Tertiapin-Q (TPN-Q) is a small compact protein that contains twenty-one amino acids, which derived from bee veno ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Macadamia integrifolia
Length	45
SwissProt ID	Q9SPL4