Home > Product > Catalog Peptides > Others > Adrenomedullin 5 (primate)

Others

Adrenomedullin 5 (primate)

[Price Inquiry]
CAT#
A05017
Sequence
HQVPQHRGHVCYLGVCRTHRLAEIIQWIRSASTKEPTGKASREPQNPYSY-NH2
M.W/Mr.
5784.55
Molecular Formula
C253H394N82O71S2
Length
50
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.