Home > Product > Antimicrobial Peptides > AnAFP

Antimicrobial Peptides

CAT#
AF3320
Sequence
SKYGGECSVEHNTCTYLKGGKDHIVSCPSAANLRCKTERHHCEYDEHHKTVDCQTPV
Host Chemicals
Aspergillus niger
Length
57
Activity
Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.