Home > Product > Catalog Peptides > β-Amyloid Mutations > [Arg6]-beta-Amyloid (1-40), England Mutation

β-Amyloid Mutations

[Arg6]-beta-Amyloid (1-40), England Mutation

Price Inquiry
CAT#
A13281
Sequence
DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
M.W/Mr.
4348.9
Length
40

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.