Home > Product > Catalog Peptides > β-Amyloid Mutations > [Arg6]-beta-Amyloid (1-40), England Mutation

β-Amyloid Mutations

warning All products are for research use only. Not for human use.

[Arg6]-beta-Amyloid (1-40), England Mutation

[Price Inquiry]
CAT#
A13281
Sequence
DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
M.W/Mr.
4348.9
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.