Home > Product > Catalog Peptides > β-Amyloid Mutations > [Lys22]-beta-Amyloid (1-42), Italian Mutation

β-Amyloid Mutations

[Lys22]-beta-Amyloid (1-42), Italian Mutation

[Price Inquiry]
CAT#
A13305
Sequence
DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA
M.W/Mr.
4513.2
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.