Home > Product > Antimicrobial Peptides > Bacteriocin curvaticin FS47

Antimicrobial Peptides

Bacteriocin curvaticin FS47

Price Inquiry
CAT#
AF2757
Sequence
YTAKQCLQAIGSCGIAGTGAGAAGGPAGAFVGAXVVXI
Host Chemicals
Lactobacillus curvatus
Length
38
Activity
Antibacterial
SwissProt ID
P80323

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.