Home > Product > Antimicrobial Peptides > Bacteriocin curvaticin FS47

Antimicrobial Peptides

Bacteriocin curvaticin FS47

[Price Inquiry]
CAT#
AF2757
Sequence
YTAKQCLQAIGSCGIAGTGAGAAGGPAGAFVGAXVVXI
Host Chemicals
Lactobacillus curvatus
Length
38
Activity
Antibacterial
SwissProt ID
P80323
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.