Home > Product > Antimicrobial Peptides > Bacteriocin SRCAM 37

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Bacteriocin SRCAM 37

[Price Inquiry]
CAT#
AF1888
Sequence
FVYGNGVTSILVQAQFLVNGQRRFFYTPDK
Host Chemicals
Paenibacillus polymyxa
Length
30
Activity
Antibacterial
SwissProt ID
P86395
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.