Home > Product > Catalog Peptides > β-Amyloid (1-42), (1-40), (1-46) and Fragments > Beta-Amyloid Peptide (1-40), mouse, rat

β-Amyloid (1-42), (1-40), (1-46) and Fragments

Beta-Amyloid Peptide (1-40), mouse, rat

[Price Inquiry]
CAT#
A13254
Sequence
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
M.W/Mr.
4233.8
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.