CAT# | AF3147 |
Sequence | GIINTLQKYYCRVRGGRCAVLTCLPKEEQIGKCSTRGRKCCRRKK |
Activity | Antibacterial |
Host Chemicals | Pan troglodytes | Length | 45 | SwissProt ID | Q95JD2 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1104 | Brevinin-1CPa | Inquiry | ||
AF2457 | TPA_exp: EP2E protein | Inquiry | ||
AF1393 | Soybean toxin 27 kDa chain | Inquiry | ||
AF745 | Ranacyclin-B-RN2 | Inquiry | ||
AF3037 | Bacteriocin divergicin M35 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...
The voltage-gated Kv1.3 channel in effector memory T cells serves as a new therapeutic target for multiple scler ...
IGF-1 IGF-1 is a single chain peptide consists of 70 amino acids in four domains, B, C, A and D. The A- and B-domains are str ...
Timonacic's chemical name, L-Syrosin-4, is a new anti-tumor drug that converts cancer cells into normal cells. E ...
Dipeptide diaminobutyroyl benzylamide diacetate, a biologically active polypeptide, classified as a neuropeptide ...