Home > Product > Antimicrobial Peptides > Beta-defensin 103A

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Beta-defensin 103A

[Price Inquiry]
CAT#
AF3147
Sequence
GIINTLQKYYCRVRGGRCAVLTCLPKEEQIGKCSTRGRKCCRRKK
Host Chemicals
Pan troglodytes
Length
45
Activity
Antibacterial
SwissProt ID
Q95JD2
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.