Home > Product > Antimicrobial Peptides > Beta-defensin C7 precursor

Antimicrobial Peptides

Beta-defensin C7 precursor

[Price Inquiry]
CAT#
AF2452
Sequence
PLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCR
Host Chemicals
Bos taurus
Length
35
Activity
Antibacterial
SwissProt ID
O18815
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.