Home > Product > Antimicrobial Peptides > Beta-defensin 2

Antimicrobial Peptides

Beta-defensin 2

[Price Inquiry]
CAT#
AF2859
Sequence
VRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW
Host Chemicals
Bubalus bubalis
Length
40
Activity
Antibacterial
SwissProt ID
P85150
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.