Home > Product > Antimicrobial Peptides > Beta-defensin 4

Antimicrobial Peptides

Beta-defensin 4

[Price Inquiry]
CAT#
AF2903
Sequence
QSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK
Host Chemicals
Rattus norvegicus
Length
41
Activity
Antibacterial
SwissProt ID
O88514
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.