Home > Product > Antimicrobial Peptides > Beta-defensin 1 , peptide BNBD-1

Antimicrobial Peptides

Beta-defensin 1 , peptide BNBD-1

[Price Inquiry]
CAT#
AF2697
Sequence
DFASCHTNGGICLPNRCPGHMIQIGICFRPRVKCCRSW
Host Chemicals
Bos taurus
Length
38
Activity
Antibacterial
SwissProt ID
P46159
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.