Home > Product > Antimicrobial Peptides > Beta-defensin118

Antimicrobial Peptides

Beta-defensin118

[Price Inquiry]
CAT#
AF2985
Sequence
AYGGEKKCWNRSGHCRKQCKDGEAVKETCKNHRACCVPSNEDH
Host Chemicals
Macaca mulatta
Length
43
Activity
Antibacterial
SwissProt ID
Q95LI0
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.