CAT# | AF2695 |
Sequence | AVKDTYSCFIMRGKCRHECHDFEKPIGFCTKLNANCYM |
Activity | Antibacterial |
Host Chemicals | Homo sapiens | Length | 38 | SwissProt ID | Q30KQ1 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2037 | Vibi G | Inquiry | ||
AF1484 | Palustrin-RA2 antimicrobial peptide | Inquiry | ||
AF228 | Temporin-1CSc | Inquiry | ||
AF277 | Temporin-CPa | Inquiry | ||
AF1990 | Dermaseptin B2 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...
Econazole, commonly used as sulfosalicylate and nitrate salt, is an imidazole broad-spectrum antifungal drug, wh ...
Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...
Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...