Home > Product > Antimicrobial Peptides > Beta-defensin133

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Beta-defensin133

[Price Inquiry]
CAT#
AF2918
Sequence
VKCAVKDTYSCFIVRGKCRHECHDFEKPIGFCTKLNANCYM
Host Chemicals
Pan troglodytes
Length
41
Activity
Antibacterial
SwissProt ID
Q30KJ6
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.