Home > Product > Catalog Peptides > Others > Calcitonin, chicken

Others

Calcitonin, chicken

[Price Inquiry]
CAT#
C06006
Sequence
CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2
M.W/Mr.
3371.9
Modifications
disulfide
Length
32
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.