Home > Product > Catalog Peptides > Others > Calcitonin (salmon I)

Others

Calcitonin (salmon I)

Price Inquiry
CAT#
C06010
Sequence
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2
M.W/Mr.
3431.90
Molecular Formula
C145H240N44O48S2
Length
32

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.