Home > Product > Catalog Peptides > Others > Calcitonin (salmon I)

Others

warning All products are for research use only. Not for human use.

Calcitonin (salmon I)

[Price Inquiry]
CAT#
C06010
Sequence
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2
M.W/Mr.
3431.90
Molecular Formula
C145H240N44O48S2
Length
32
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.