Calcitonin salmon

Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1263
Chemical Structure
CAS	47931-85-1
Synonyms/Alias	Salmon calcitonin
M.F/Formula	C₁₄₅H₂₄₀N₄₄O₄₈S₂
M.W/Mr.	3431.85
Sequence	One Letter Code: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: Cys1-Cys7) three Letter Code: Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7)
Biological Activity	Stimulates bone formation by osteoblasts and inhibits bone resorption.

CAT#	Product Name	Inquiry
R2042	S-(2,4-Dinitrophenyl)glutathione	Inquiry
R1413	Hemokinin 1 mouse	Inquiry
R0869	BIM 189	Inquiry
R1735	Tyr-Somatostatin-14	Inquiry
R1549	Neurotensin	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Storage	Desiccate at -20°C
Solubility	Soluble to 1 mg/ml in water
Shipping Condition	Room temperature in continental US; may vary elsewhere.