Home > Product > Antimicrobial Peptides > Carnobacteriocin B2

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Carnobacteriocin B2

[Price Inquiry]
CAT#
AF2333
Sequence
XNYGNGVSCSKTKCSVNWGQAFQERYTAGINSF
Host Chemicals
Carnobacterium maltaromaticum
Length
33
Activity
Antimicrobial
SwissProt ID
P38580
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.