Home > Product > Antimicrobial Peptides > Chrombacin

Antimicrobial Peptides

Chrombacin

[Price Inquiry]
CAT#
AF3331
Sequence
AAEFPDFYDSEEQMGPHQEAEDEKDRADQRVLTEEEKKELENLAAMDLELQKIAEKFSQR
Host Chemicals
Bos taurus
Length
60
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.