Home > Product > Antimicrobial Peptides > Cliotide T1

Antimicrobial Peptides

Cliotide T1

[Price Inquiry]
CAT#
AF1914
Sequence
GIPCGESCVFIPCITGAIGCSCKSKVCYRN
Host Chemicals
Clitoria ternatea
Length
30
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.