Home > Product > Antimicrobial Peptides > Cliotide T7

Antimicrobial Peptides

Cliotide T7

[Price Inquiry]
CAT#
AF2009
Sequence
GIPCGESCVFIPCTVTALLGCSCKDKVCYKN
Host Chemicals
Clitoria ternatea
Length
31
Activity
Cancer cells
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.