Home > Product > Antimicrobial Peptides > Defensin 2-2, partial

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Defensin 2-2, partial

[Price Inquiry]
CAT#
AF2935
Sequence
FSCDVLSFQSKWVSPNHSACAVRCLAQRRKGGKCKNGDCVCR
Host Chemicals
Synthetic construct
Length
42
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.