Home > Product > Antimicrobial Peptides > Dermaseptin-J10

Antimicrobial Peptides

Dermaseptin-J10

[Price Inquiry]
CAT#
AF1873
Sequence
ALWKSLLKGAGQLVGGVVQHFMGSQGQPES
Host Chemicals
Phasmahyla jandaia
Length
30
Activity
Antimicrobial
SwissProt ID
P86642
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.