Home > Product > Catalog Peptides > Others > [Des-Tyr1] b-Endorphin, human

Others

[Des-Tyr1] b-Endorphin, human

Price Inquiry
CAT#
E05021
Sequence
GGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
M.W/Mr.
3302.0
Molecular Formula
C149H242N38O44S1
Length
30

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.