Home > Product > Catalog Peptides > Others > [Des-Tyr1] b-Endorphin, human

Others

[Des-Tyr1] b-Endorphin, human

[Price Inquiry]
CAT#
E05021
Sequence
GGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
M.W/Mr.
3302.0
Molecular Formula
C149H242N38O44S1
Length
30
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.