Home > Product > Antimicrobial Peptides > Enhancer of rudimentary homolog

Antimicrobial Peptides

Enhancer of rudimentary homolog

[Price Inquiry]
CAT#
AF2143
Sequence
RADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Host Chemicals
Sus scrofa
Length
32
Activity
Antibacterial
SwissProt ID
P80230
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.