Home > Product > Antimicrobial Peptides > Esculentin-2-OG6 antimicrobial peptide

Antimicrobial Peptides

Esculentin-2-OG6 antimicrobial peptide

[Price Inquiry]
CAT#
AF2620
Sequence
GLFTLIKGAAKLIGKTVVKEAGKTGLELMACKITNQC
Host Chemicals
Odorrana grahami
Length
37
Activity
Antimicrobial
SwissProt ID
A6MAX9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.