Home > Product > Catalog Peptides > Others > Galanin (1-13)-Spantide I

Others

warning All products are for research use only. Not for human use.

Galanin (1-13)-Spantide I

[Price Inquiry]
CAT#
G01011
Sequence
GWTLNSAGYLLGPDRPKPQQDWFDWLL-NH2
M.W/Mr.
2828.3
Molecular Formula
C138H199N35O30
Length
27
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.