Home > Product > Catalog Peptides > Others > Galanin (1-13)-Spantide I

Others

Galanin (1-13)-Spantide I

Price Inquiry
CAT#
G01011
Sequence
GWTLNSAGYLLGPDRPKPQQDWFDWLL-NH2
M.W/Mr.
2828.3
Molecular Formula
C138H199N35O30
Length
27

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.