Home > Product > Antimicrobial Peptides > Gallin protein

Antimicrobial Peptides

Gallin protein

[Price Inquiry]
CAT#
AF3049
Sequence
YGLVLKYCPKIGYCSNTCSKTQIWATSHGCKMYCCLPASWKWK
Host Chemicals
Gallus gallus
Length
43
Activity
Antibacterial
SwissProt ID
D5GR55
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.