Home > Product > Antimicrobial Peptides > Gallinacin-10

Antimicrobial Peptides

Gallinacin-10

[Price Inquiry]
CAT#
AF2993
Sequence
FPDTVACRTQGNFCRAGACPPTFTISGQCHGGLLNCCAKIPAQ
Host Chemicals
Gallus gallus
Length
43
Activity
Antibacterial
SwissProt ID
Q6QLQ9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.