Home > Product > Catalog Peptides > β-Amyloid Mutations > [Gln22, Asn23]-beta-Amyloid (1-40), E22Q/D23N Dutch/Iowa double mutation

β-Amyloid Mutations

[Gln22, Asn23]-beta-Amyloid (1-40), E22Q/D23N Dutch/Iowa double mutation

[Price Inquiry]
CAT#
A13267
Sequence
DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
M.W/Mr.
4327.9
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.