Home > Product > Catalog Peptides > Others > Glucagon (1 - 29), bovine, human, porcine, FAM- - labeled

Others

warning All products are for research use only. Not for human use.

Glucagon (1 - 29), bovine, human, porcine, FAM- - labeled

[Price Inquiry]
CAT#
G05009
Sequence
FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
M.W/Mr.
3841.1
Length
33
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.