Home > Product > Catalog Peptides > Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2) > Glucagon (1 - 29), bovine, human, porcine, FAM- - labeled

Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2)

Glucagon (1 - 29), bovine, human, porcine, FAM- - labeled

Price Inquiry
CAT#
G05009
Sequence
FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
M.W/Mr.
3841.1
Length
33

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.