Keywords Search Google Search Search

Handle region peptide, rat

Handle region peptide, rat is a prorenin receptor antagonist, suppresses the progression of diabetic nephropathy and has anti-inflammatory in the eye.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1411
CAS	749227-53-0
M.F/Formula	C₅₄H₁₀₁N₁₅O₁₂ S
M.W/Mr.	1184.54
Sequence	One Letter Code: RILLKKMPSV three Letter Code: Arg-Ile-Leu-Leu-Lys-Lys-Met-Pro-Ser-Val

CAT#	Product Name	Inquiry
R0936	ProTx I	Inquiry
R1403	GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	Inquiry
R1595	PACAP-38 (16-38), human, mouse, rat	Inquiry
R1492	Luciferase	Inquiry
R1872	HGH(1-43)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of myristoyl hexapeptide-4 for improvement of skin

Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...

Myristoyl Octapeptide-1 promotes a healthy appearance of the skin

The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...

Gap 19: Specifically block Cx43 hemichannels inhibitor

Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...

Abaloparatide Helps Osteoporotic Fractures Treatment

What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...

Function of myristoyl pentapeptide-7 in skin and eyelash

Myristoyl pentapeptide-7, a cosmetic peptide, is a synthetic peptide containing lysine and threonine residues, w ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: