Home > Product > Antimicrobial Peptides > Hepcidin-like antimicrobial peptide precursor

Antimicrobial Peptides

Hepcidin-like antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF2969
Sequence
YEETSAETWMMPFNIRGEQQSGAIKCHFCCSCCAFGVCGTCC
Host Chemicals
Epinephelus fuscoguttatus
Length
42
Activity
Antimicrobial
SwissProt ID
F1CNA5
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.