Home > Product > Antimicrobial Peptides > Human lactoferricin

Antimicrobial Peptides

Human lactoferricin

[Price Inquiry]
CAT#
AF3253
Sequence
GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQA
Host Chemicals
Homo sapiens
Length
49
Activity
Gram+ & Gram-,
SwissProt ID
PDB ID: 1Z6V
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.