Home > Product > Antimicrobial Peptides > Human lactoferricin

Antimicrobial Peptides

Human lactoferricin

Price Inquiry
CAT#
AF3253
Sequence
GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQA
Host Chemicals
Homo sapiens
Length
49
Activity
Gram+ & Gram-,
SwissProt ID
PDB ID: 1Z6V

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.