Home > Product > Antimicrobial Peptides > Hypothetical protein

Antimicrobial Peptides

Hypothetical protein

[Price Inquiry]
CAT#
AF2385
Sequence
RIVDCKRSEGFCQEYCNYLETQVGYCSKKKDACC
Host Chemicals
Macaca fascicularis
Length
34
Activity
Antimicrobial
SwissProt ID
Q95LR9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.