Home > Product > Antimicrobial Peptides > Hypothetical protein

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Hypothetical protein

[Price Inquiry]
CAT#
AF2385
Sequence
RIVDCKRSEGFCQEYCNYLETQVGYCSKKKDACC
Host Chemicals
Macaca fascicularis
Length
34
Activity
Antimicrobial
SwissProt ID
Q95LR9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.