CAT# | AF2385 |
Sequence | RIVDCKRSEGFCQEYCNYLETQVGYCSKKKDACC |
Activity | Antimicrobial |
Host Chemicals | Macaca fascicularis | Length | 34 | SwissProt ID | Q95LR9 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1509 | Ranatuerin-1C | Inquiry | ||
AF866 | Ranacyclin-B-RN6 | Inquiry | ||
AF1701 | Dinoponeratoxin Da-3177 | Inquiry | ||
AF2083 | Brevinin-2-RA19 peptide precursor | Inquiry | ||
AF2768 | European bumblebee abaecin | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...
Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...
Margatoxin (MgTX) is a 39 amino acid peptide with significant sequence homology to charybdotoxin (ChTX), and ha ...
PKC (19-36), a synthetic peptide of the pseudosubstrate domain of the kinase, is a selective inhibitor of prote ...
of Tripeptide-1 The tripeptide-1 (glycyl-L-histadyl-L-lysine or GHK) is primarily known as carrier peptides. It ...