Home > Product > Catalog Peptides > Others > (Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)

Others

warning All products are for research use only. Not for human use.

(Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)

[Price Inquiry]
CAT#
P03037
Sequence
AVSEIQLLHDKGKSIQDLRRRFWLHHLIAEIHTAEY
M.W/Mr.
4324.96
Molecular Formula
C196H308N58O53
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.