Home > Product > Catalog Peptides > Others > (Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)

Others

(Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)

Price Inquiry
CAT#
P03037
Sequence
AVSEIQLLHDKGKSIQDLRRRFWLHHLIAEIHTAEY
M.W/Mr.
4324.96
Molecular Formula
C196H308N58O53
Length
36

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.