Home > Product > Catalog Peptides > Others > Parathyroid Hormone (3-34), bovine

Others

Parathyroid Hormone (3-34), bovine

Price Inquiry
CAT#
P03024
Sequence
SEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF
M.W/Mr.
3938.6
Molecular Formula
C175H274N52O48S2
Length
32

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.