Home > Product > Catalog Peptides > Others > Parathyroid Hormone (3-34), bovine

Others

warning All products are for research use only. Not for human use.

Parathyroid Hormone (3-34), bovine

[Price Inquiry]
CAT#
P03024
Sequence
SEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF
M.W/Mr.
3938.6
Molecular Formula
C175H274N52O48S2
Length
32
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.