Home > Product > Antimicrobial Peptides > Ir-Def1

Antimicrobial Peptides

CAT#
AF2583
Sequence
GGYYCPFFQDKCHRHCRSFGRKAGYCGGFLKKTCICV
Host Chemicals
Ixodes ricinus
Length
37
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.