Home > Product > Antimicrobial Peptides > 4 kDa defensin

Antimicrobial Peptides

4 kDa defensin

[Price Inquiry]
CAT#
AF2706
Sequence
GFGCPLNQGACHRHCRSIRRRGGYCAGFFKQTCTCYRN
Host Chemicals
Leiurus quinquestriatus hebraeus
Length
38
Activity
Antibacterial
SwissProt ID
P41965
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.