Home > Product > Antimicrobial Peptides > 4 kDa defensin

Antimicrobial Peptides

4 kDa defensin

Price Inquiry
CAT#
AF2706
Sequence
GFGCPLNQGACHRHCRSIRRRGGYCAGFFKQTCTCYRN
Host Chemicals
Leiurus quinquestriatus hebraeus
Length
38
Activity
Antibacterial
SwissProt ID
P41965

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.