Home > Product > Catalog Peptides > Others > Lepirudin

Others

Lepirudin

Price Inquiry
CAT#
T05018
Sequence
LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ
Molecular Formula
C287H440N80O111S6
Length
65

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.