Home > Product > Catalog Peptides > Others > Lepirudin

Others

warning All products are for research use only. Not for human use.
CAT#
T05018
Sequence
LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ
Molecular Formula
C287H440N80O111S6
Length
65
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.