Home > Product > Antimicrobial Peptides > MCdef

Antimicrobial Peptides

CAT#
AF3085
Sequence
GFGCPNDYSCSNHCRDSIGCRGGYCKYQLICTCYGCKKRRSIQE
Host Chemicals
adductor, foot, gill, hemocyte, mantle, palp, and siphon; Manila clams, Ruditapes philippinarum
Length
44
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.