Home > Product > Antimicrobial Peptides > Milk lysozyme

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Milk lysozyme

[Price Inquiry]
CAT#
AF3157
Sequence
MKALLILGLLLFSVAVQGKVFERCELARSLKRFGMDNFRGISLAN
Host Chemicals
Bos indicus x Bos taurus (hybrid cattle)
Length
45
Activity
Antimicrobial
SwissProt ID
Q0MRQ0
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.