CAT# | AF2725 |
Sequence | KVPIGAIKKGGKIIKKGLGVLGAAGTAHEVYNHVRNRQ |
Activity | Antibacterial, Antifungal |
Host Chemicals | Galleria mellonella | Length | 38 | SwissProt ID | A5JSU8 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2186 | Brevinin-2PTe | Inquiry | ||
AF1001 | Ranacyclin-AJ antimicrobial peptide precursor | Inquiry | ||
AF1857 | Def-Daa | Inquiry | ||
AF1991 | EC-proHep3 | Inquiry | ||
AF2632 | Esculentin-2PRa | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Enfuvirtide, also named pentafuside, is an HIV fusion inhibitor originated at Duke University, where researchers ...
GIP is a 42-aminoacid peptide secreted from the intestinal K-cells (located mainly in the duodenum and proximal jejunum) and ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
Glutathione (γ-Glu-Cys-Gly, GSH) is the most abundant antioxidant in animal tissues, at 0.1-10 mM, as well as i ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...