Home > Product > Antimicrobial Peptides > Neutrophil defensin1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Neutrophil defensin1

[Price Inquiry]
CAT#
AF1866
Sequence
ACYCRIPACLAGERRYGTCIYQGRLWAFCC
Host Chemicals
Pan troglodytes
Length
30
Activity
Antibacterial, Antifungal, Antiviral
SwissProt ID
Q5G863
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.