Home > Product > Antimicrobial Peptides > Neutrophil defensin1

Antimicrobial Peptides

Neutrophil defensin1

Price Inquiry
CAT#
AF1866
Sequence
ACYCRIPACLAGERRYGTCIYQGRLWAFCC
Host Chemicals
Pan troglodytes
Length
30
Activity
Antibacterial, Antifungal, Antiviral
SwissProt ID
Q5G863

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.