Home > Product > Antimicrobial Peptides > Odorranain-A-RA1 peptide precursor

Antimicrobial Peptides

Odorranain-A-RA1 peptide precursor

[Price Inquiry]
CAT#
AF2849
Sequence
PMKKSLCLLFFLGTISLSLCEQERDADEEEGSENGAEDIK
Host Chemicals
Odorrana andersonii (golden crossband frog)
Length
40
Activity
Antimicrobial
SwissProt ID
E3SZ88
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.