Home > Product > Catalog Peptides > Others > Parathyroid Hormone (1-38), human

Others

warning All products are for research use only. Not for human use.

Parathyroid Hormone (1-38), human

[Price Inquiry]
CAT#
P03041
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG
M.W/Mr.
4458.2
Molecular Formula
C197H319N59O55S2
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.