Home > Product > Catalog Peptides > Others > [Tyr0]-Hypercalcemia Malignancy Factor (1-40)

Others

[Tyr0]-Hypercalcemia Malignancy Factor (1-40)

[Price Inquiry]
CAT#
P03044
Sequence
YAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATS
M.W/Mr.
4838.5
Length
41
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.