Home > Product > Catalog Peptides > Others > [Tyr0]-Hypercalcemia Malignancy Factor (1-40)

Others

[Tyr0]-Hypercalcemia Malignancy Factor (1-40)

Price Inquiry
CAT#
P03044
Sequence
YAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATS
M.W/Mr.
4838.5
Length
41

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.