Home > Product > Catalog Peptides > Others > pTH-Related Protein Splice Isoform 3 (140-173) (human)

Others

pTH-Related Protein Splice Isoform 3 (140-173) (human)

[Price Inquiry]
CAT#
P03028
Sequence
TALLWGLKKKKENNRRTHHMQLMISLFKSPLLLL
M.W/Mr.
4059.99
Molecular Formula
C186H313N53O44S2
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.